![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies) sandwich of half-barrel shaped beta-sheets |
![]() | Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families) ![]() |
![]() | Family b.84.2.1: BC C-terminal domain-like [51247] (5 proteins) probable rudiment form of the biotinyl-carrier domain |
![]() | Protein Biotin carboxylase (BC), C-domain [51248] (2 species) subunit of acetyl-CoA and pyruvate carboxylases |
![]() | Species Aquifex aeolicus [TaxId:63363] [102004] (1 PDB entry) |
![]() | Domain d1ulza1: 1ulz A:329-451 [99575] Other proteins in same PDB: d1ulza2, d1ulza3 |
PDB Entry: 1ulz (more details), 2.2 Å
SCOPe Domain Sequences for d1ulza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ulza1 b.84.2.1 (A:329-451) Biotin carboxylase (BC), C-domain {Aquifex aeolicus [TaxId: 63363]} fngyaiecrinaedpkknfapstrvieryyvpggfgirvehaaargfevtpyydsmiakl itwaptwdeavermraaletyeitgvkttipllinimkekdfkagkfttkyleehpevfe yee
Timeline for d1ulza1: