| Class b: All beta proteins [48724] (141 folds) |
| Fold b.84: Barrel-sandwich hybrid [51229] (3 superfamilies) sandwich of half-barrel shaped beta-sheets |
Superfamily b.84.2: Rudiment single hybrid motif [51246] (2 families) ![]() |
| Family b.84.2.1: BC C-terminal domain-like [51247] (4 proteins) probable rudiment form of the biotinyl-carrier domain |
| Protein Biotin carboxylase (BC), C-domain [51248] (2 species) subunit of acetyl-CoA and pyruvate carboxylases |
| Species Aquifex aeolicus [TaxId:63363] [102004] (1 PDB entry) |
| Domain d1ulza1: 1ulz A:329-451 [99575] Other proteins in same PDB: d1ulza2, d1ulza3 mutant |
PDB Entry: 1ulz (more details), 2.2 Å
SCOP Domain Sequences for d1ulza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ulza1 b.84.2.1 (A:329-451) Biotin carboxylase (BC), C-domain {Aquifex aeolicus}
fngyaiecrinaedpkknfapstrvieryyvpggfgirvehaaargfevtpyydsmiakl
itwaptwdeavermraaletyeitgvkttipllinimkekdfkagkfttkyleehpevfe
yee
Timeline for d1ulza1: