Lineage for d1ulza2 (1ulz A:1-114)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 392624Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 392625Superfamily c.30.1: PreATP-grasp domain [52440] (6 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 392626Family c.30.1.1: BC N-terminal domain-like [52441] (5 proteins)
  6. 392627Protein Biotin carboxylase (BC), N-terminal domain [52442] (2 species)
    subunit of acetyl-CoA and pyruvate carboxylases
  7. 392628Species Aquifex aeolicus [TaxId:63363] [102283] (1 PDB entry)
  8. 392629Domain d1ulza2: 1ulz A:1-114 [99576]
    Other proteins in same PDB: d1ulza1, d1ulza3
    mutant

Details for d1ulza2

PDB Entry: 1ulz (more details), 2.2 Å

PDB Description: Crystal structure of the biotin carboxylase subunit of pyruvate carboxylase

SCOP Domain Sequences for d1ulza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ulza2 c.30.1.1 (A:1-114) Biotin carboxylase (BC), N-terminal domain {Aquifex aeolicus}
mvnkvlvanrgeiavriirackelgiptvaiynevestarhvkladeaymigtdpldtyl
nkqriinlalevgadaihpgygflaenaefakmceeagitfigphwkvielmgd

SCOP Domain Coordinates for d1ulza2:

Click to download the PDB-style file with coordinates for d1ulza2.
(The format of our PDB-style files is described here.)

Timeline for d1ulza2: