![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
![]() | Superfamily d.26.1: FKBP-like [54534] (4 families) ![]() |
![]() | Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins) |
![]() | Protein FKBP13 [110870] (1 species) |
![]() | Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [110871] (2 PDB entries) Uniprot Q9SCY2 84-208 |
![]() | Domain d1u79a_: 1u79 A: [107714] |
PDB Entry: 1u79 (more details), 1.85 Å
SCOPe Domain Sequences for d1u79a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u79a_ d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} cefsvspsglafcdkvvgygpeavkgqlikahyvgklengkvfdssynrgkpltfrigvg evikgwdqgilgsdgippmltggkrtlrippelaygdrgagckggsclippasvllfdie yigka
Timeline for d1u79a_:
![]() Domains from other chains: (mouse over for more information) d1u79b_, d1u79c_, d1u79d_, d1u79e_ |