Lineage for d1u79a_ (1u79 A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 501849Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 501850Superfamily d.26.1: FKBP-like [54534] (3 families) (S)
  5. 501851Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (16 proteins)
  6. 501916Protein FKBP13 [110870] (1 species)
  7. 501917Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [110871] (1 PDB entry)
  8. 501918Domain d1u79a_: 1u79 A: [107714]

Details for d1u79a_

PDB Entry: 1u79 (more details), 1.85 Å

PDB Description: Crystal structure of AtFKBP13

SCOP Domain Sequences for d1u79a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u79a_ d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis thaliana)}
cefsvspsglafcdkvvgygpeavkgqlikahyvgklengkvfdssynrgkpltfrigvg
evikgwdqgilgsdgippmltggkrtlrippelaygdrgagckggsclippasvllfdie
yigka

SCOP Domain Coordinates for d1u79a_:

Click to download the PDB-style file with coordinates for d1u79a_.
(The format of our PDB-style files is described here.)

Timeline for d1u79a_: