PDB entry 1u79

View 1u79 on RCSB PDB site
Description: Crystal structure of AtFKBP13
Class: isomerase
Keywords: tFKBP13, FK-506 BINDING PROTEIN, ISOMERASE
Deposited on 2004-08-03, released 2004-09-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.212
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FKBP-type peptidyl-prolyl cis-trans isomerase 3
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: AtFKBP13
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u79a_
  • Chain 'B':
    Compound: FKBP-type peptidyl-prolyl cis-trans isomerase 3
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: AtFKBP13
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u79b_
  • Chain 'C':
    Compound: FKBP-type peptidyl-prolyl cis-trans isomerase 3
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: AtFKBP13
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u79c_
  • Chain 'D':
    Compound: FKBP-type peptidyl-prolyl cis-trans isomerase 3
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: AtFKBP13
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u79d_
  • Chain 'E':
    Compound: FKBP-type peptidyl-prolyl cis-trans isomerase 3
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: AtFKBP13
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u79e_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u79A (A:)
    ettscefsvspsglafcdkvvgygpeavkgqlikahyvgklengkvfdssynrgkpltfr
    igvgevikgwdqgilgsdgippmltggkrtlrippelaygdrgagckggsclippasvll
    fdieyigka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u79A (A:)
    cefsvspsglafcdkvvgygpeavkgqlikahyvgklengkvfdssynrgkpltfrigvg
    evikgwdqgilgsdgippmltggkrtlrippelaygdrgagckggsclippasvllfdie
    yigka
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u79B (B:)
    ettscefsvspsglafcdkvvgygpeavkgqlikahyvgklengkvfdssynrgkpltfr
    igvgevikgwdqgilgsdgippmltggkrtlrippelaygdrgagckggsclippasvll
    fdieyigka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u79B (B:)
    cefsvspsglafcdkvvgygpeavkgqlikahyvgklengkvfdssynrgkpltfrigvg
    evikgwdqgilgsdgippmltggkrtlrippelaygdrgagckggsclippasvllfdie
    yigka
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1u79C (C:)
    ettscefsvspsglafcdkvvgygpeavkgqlikahyvgklengkvfdssynrgkpltfr
    igvgevikgwdqgilgsdgippmltggkrtlrippelaygdrgagckggsclippasvll
    fdieyigka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u79C (C:)
    cefsvspsglafcdkvvgygpeavkgqlikahyvgklengkvfdssynrgkpltfrigvg
    evikgwdqgilgsdgippmltggkrtlrippelaygdrgagckggsclippasvllfdie
    yigka
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1u79D (D:)
    ettscefsvspsglafcdkvvgygpeavkgqlikahyvgklengkvfdssynrgkpltfr
    igvgevikgwdqgilgsdgippmltggkrtlrippelaygdrgagckggsclippasvll
    fdieyigka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u79D (D:)
    cefsvspsglafcdkvvgygpeavkgqlikahyvgklengkvfdssynrgkpltfrigvg
    evikgwdqgilgsdgippmltggkrtlrippelaygdrgagckggsclippasvllfdie
    yigka
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1u79E (E:)
    ettscefsvspsglafcdkvvgygpeavkgqlikahyvgklengkvfdssynrgkpltfr
    igvgevikgwdqgilgsdgippmltggkrtlrippelaygdrgagckggsclippasvll
    fdieyigka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u79E (E:)
    cefsvspsglafcdkvvgygpeavkgqlikahyvgklengkvfdssynrgkpltfrigvg
    evikgwdqgilgsdgippmltggkrtlrippelaygdrgagckggsclippasvllfdie
    yigka