Lineage for d1u79b_ (1u79 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2941336Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 2941337Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 2941338Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins)
  6. 2941420Protein FKBP13 [110870] (1 species)
  7. 2941421Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [110871] (2 PDB entries)
    Uniprot Q9SCY2 84-208
  8. 2941423Domain d1u79b_: 1u79 B: [107715]

Details for d1u79b_

PDB Entry: 1u79 (more details), 1.85 Å

PDB Description: Crystal structure of AtFKBP13
PDB Compounds: (B:) FKBP-type peptidyl-prolyl cis-trans isomerase 3

SCOPe Domain Sequences for d1u79b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u79b_ d.26.1.1 (B:) FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
cefsvspsglafcdkvvgygpeavkgqlikahyvgklengkvfdssynrgkpltfrigvg
evikgwdqgilgsdgippmltggkrtlrippelaygdrgagckggsclippasvllfdie
yigka

SCOPe Domain Coordinates for d1u79b_:

Click to download the PDB-style file with coordinates for d1u79b_.
(The format of our PDB-style files is described here.)

Timeline for d1u79b_: