Lineage for d1t4ga2 (1t4g A:65-322)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
3 layers: a/b/a, parallel or mixed beta-sheets of variable sizesSuperfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) 
division into families based on beta-sheet topologies
Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (22 proteins)
core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
Protein DNA repair protein Rad51, catalytic domain [82412] (7 species) 
Species Methanococcus voltae [TaxId:2188] [110555] (14 PDB entries)
Uniprot O73948
Domain d1t4ga2: 1t4g A:65-322 [106419]
Other proteins in same PDB: d1t4ga1
complexed with anp, mg
Details for d1t4ga2
PDB Entry: 1t4g (more details), 2 Å
PDB Description: atpase in complex with amp-pnp
PDB Compounds: (A:) DNA repair and recombination protein radASCOPe Domain Sequences for d1t4ga2:
Sequence, based on SEQRES records: (download)
>d1t4ga2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Methanococcus voltae [TaxId: 2188]}
ksgidllkqrstvwklstssseldsvlggglesqsvtefagvfgsgktqimhqscvnlqn
peflfydeeavskgevaqpkavyidtegtfrperimqmaehagidgqtvldntfvarayn
sdmqmlfaekiedliqegnniklvvidsltstfrneytgrgklaerqqklgrhmatlnkl
adlfncvvlvtnqvsakpdaffgmaeqaigghivghaatfrffvrkgkgdkrvaklydsp
hlpdaeaifritekgiqd
Sequence, based on observed residues (ATOM records): (download)
>d1t4ga2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Methanococcus voltae [TaxId: 2188]}
ksgidllkqrstvwklstssseldsvlggglesqsvtefagvfgsgktqimhqscvnlqn
peflfydeeavskgevaqpkavyidtegtfrperimqmaehagidgqtvldntfvarayn
sdmqmlfaekiedliqegnniklvvidsltstfrneytgrgklaerqqklgrhmatlnkl
adlfncvvlvtnqvsghaatfrffvrkgkgdkrvaklydsphlpdaeaifritekgiqd
SCOPe Domain Coordinates for d1t4ga2:
Click to download the PDB-style file with coordinates for d1t4ga2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1t4ga2:
- d1t4ga2 first appeared in SCOP 1.69
- d1t4ga2 appears in SCOPe 2.07
View in 3D
