PDB entry 1t4g

View 1t4g on RCSB PDB site
Description: ATPase in complex with AMP-PNP
Class: recombination
Keywords: ATPase, Protein-ATP complex, RECOMBINATION
Deposited on 2004-04-29, released 2004-08-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA repair and recombination protein radA
    Species: Methanococcus voltae [TaxId:2188]
    Gene: RADA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1t4ga1, d1t4ga2
  • Heterogens: MG, ANP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t4gA (A:)
    mgdnltdlpgvgpstaeklveagyidfmkiatatvgeltdiegisekaaakmimgardlc
    dlgfksgidllkqrstvwklstssseldsvlggglesqsvtefagvfgsgktqimhqscv
    nlqnpeflfydeeavskgevaqpkavyidtegtfrperimqmaehagidgqtvldntfva
    raynsdmqmlfaekiedliqegnniklvvidsltstfrneytgrgklaerqqklgrhmat
    lnkladlfncvvlvtnqvsakpdaffgmaeqaigghivghaatfrffvrkgkgdkrvakl
    ydsphlpdaeaifritekgiqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t4gA (A:)
    ltdlpgvgpstaeklveagyidfmkiatatvgeltdiegisekaaakmimgardlcdlgf
    ksgidllkqrstvwklstssseldsvlggglesqsvtefagvfgsgktqimhqscvnlqn
    peflfydeeavskgevaqpkavyidtegtfrperimqmaehagidgqtvldntfvarayn
    sdmqmlfaekiedliqegnniklvvidsltstfrneytgrgklaerqqklgrhmatlnkl
    adlfncvvlvtnqvsghaatfrffvrkgkgdkrvaklydsphlpdaeaifritekgiqd