![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) ![]() conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures |
![]() | Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (12 proteins) contains a catalytic Cys-His-Glu triad |
![]() | Protein FGAM synthase PurL, amidotransferase domain [110484] (3 species) |
![]() | Species Salmonella typhimurium [TaxId:90371] [110485] (1 PDB entry) Uniprot P74881 |
![]() | Domain d1t3ta2: 1t3t A:1034-1295 [106382] Other proteins in same PDB: d1t3ta1, d1t3ta3, d1t3ta4, d1t3ta5, d1t3ta6, d1t3ta7, d1t3ta8 complexed with adp, mg, so4 |
PDB Entry: 1t3t (more details), 1.9 Å
SCOPe Domain Sequences for d1t3ta2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t3ta2 c.23.16.1 (A:1034-1295) FGAM synthase PurL, amidotransferase domain {Salmonella typhimurium [TaxId: 90371]} iatgarpkvavlreqgvnshvemaaafhragfdaidvhmsdllggriglgnfhalvacgg fsygdvlgagegwaksilfnhrvrdefetffhrpqtlalgvcngcqmmsnlrelipgsel wprfvrnhsdrfearfslvevtqspslllqgmvgsqmpiavshgegrvevrddahlaale skglvalryvdnfgkvtetypanpngspngitavttengrvtimmphpervfrtvanswh penwgedspwmrifrnarkqlg
Timeline for d1t3ta2: