Lineage for d1sqia2 (1sqi A:175-366)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1645158Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 1645159Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 1645312Family d.32.1.3: Extradiol dioxygenases [54602] (4 proteins)
    duplication: consists of 2 similar domains with 2 repeats in each
    Similar to the Methylmalonyl-CoA epimerase dimer
  6. 1645348Protein 4-hydroxyphenylpyruvate dioxygenase, HppD [54608] (6 species)
  7. 1645361Species Norway rat (Rattus norvegicus) [TaxId:10116] [256396] (1 PDB entry)
    Uniprot P32755
  8. 1645363Domain d1sqia2: 1sqi A:175-366 [105915]
    complexed with 869, fe

Details for d1sqia2

PDB Entry: 1sqi (more details), 2.15 Å

PDB Description: Structural basis for inhibitor selectivity revealed by crystal structures of plant and mammalian 4-hydroxyphenylpyruvate dioxygenases
PDB Compounds: (A:) 4-hydroxyphenylpyruvic acid dioxygenase

SCOPe Domain Sequences for d1sqia2:

Sequence, based on SEQRES records: (download)

>d1sqia2 d.32.1.3 (A:175-366) 4-hydroxyphenylpyruvate dioxygenase, HppD {Norway rat (Rattus norvegicus) [TaxId: 10116]}
scnleiidhivgnqpdqemesasewylknlqfhrfwsvddtqvhteysslrsivvanyee
sikmpinepapgrkksqiqeyvdynggagvqhialrtediittirhlrergmeflavpss
yyrllrenlktskiqvkenmdvleelkilvdydekgyllqiftkpmqdrptlfleviqrh
nhqgfgagnfns

Sequence, based on observed residues (ATOM records): (download)

>d1sqia2 d.32.1.3 (A:175-366) 4-hydroxyphenylpyruvate dioxygenase, HppD {Norway rat (Rattus norvegicus) [TaxId: 10116]}
scnleiidhivgnqpdqemesasewylknlqfhrfwsvlrsivvanyeesikmpinepas
qiqeyvdynggagvqhialrtediittirhlrergmeflavpssyyrllrenlktskiqv
kenmdvleelkilvdydekgyllqiftkpmqdrptlfleviqrhnhqgfgagnfns

SCOPe Domain Coordinates for d1sqia2:

Click to download the PDB-style file with coordinates for d1sqia2.
(The format of our PDB-style files is described here.)

Timeline for d1sqia2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1sqia1