SCOPe 2.08: Domain d1sqia2: 1sqi A:175-366

Lineage for d1sqia2 (1sqi A:175-366)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families)

5. Family d.32.1.3: Extradiol dioxygenases [54602] (5 proteins)
   duplication: consists of 2 similar domains with 2 repeats in each
   Similar to the Methylmalonyl-CoA epimerase dimer

6. Protein 4-hydroxyphenylpyruvate dioxygenase, HppD [54608] (6 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [256396] (1 PDB entry)
   Uniprot P32755

8. Domain d1sqia2: 1sqi A:175-366 [105915]
   complexed with 869, fe

Details for d1sqia2

PDB Entry: 1sqi, 2.15 Å

PDB Description: Structural basis for inhibitor selectivity revealed by crystal structures of plant and mammalian 4-hydroxyphenylpyruvate dioxygenases

PDB Compounds: (A:) 4-hydroxyphenylpyruvic acid dioxygenase

SCOPe Domain Sequences for d1sqia2:

Sequence, based on SEQRES records:

>d1sqia2 d.32.1.3 (A:175-366) 4-hydroxyphenylpyruvate dioxygenase, HppD {Norway rat (Rattus norvegicus) [TaxId: 10116]}
scnleiidhivgnqpdqemesasewylknlqfhrfwsvddtqvhteysslrsivvanyee
sikmpinepapgrkksqiqeyvdynggagvqhialrtediittirhlrergmeflavpss
yyrllrenlktskiqvkenmdvleelkilvdydekgyllqiftkpmqdrptlfleviqrh
nhqgfgagnfns

Sequence, based on observed residues (ATOM records):

>d1sqia2 d.32.1.3 (A:175-366) 4-hydroxyphenylpyruvate dioxygenase, HppD {Norway rat (Rattus norvegicus) [TaxId: 10116]}
scnleiidhivgnqpdqemesasewylknlqfhrfwsvlrsivvanyeesikmpinepas
qiqeyvdynggagvqhialrtediittirhlrergmeflavpssyyrllrenlktskiqv
kenmdvleelkilvdydekgyllqiftkpmqdrptlfleviqrhnhqgfgagnfns

Timeline for d1sqia2:

• d1sqia2 first appeared in SCOP 1.69
  
• d1sqia2 appears in SCOPe 2.07