Lineage for d1r6da_ (1r6d A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841375Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

    has additional subdomain(s) that are not in the common domain
  6. 2842012Protein dTDP-glucose 4,6-dehydratase (RmlB) [51755] (4 species)
  7. 2842034Species Streptomyces venezuelae [TaxId:54571] [102133] (2 PDB entries)
  8. 2842035Domain d1r6da_: 1r6d A: [97148]
    complexed with dau, nad; mutant
    has additional subdomain(s) that are not in the common domain

Details for d1r6da_

PDB Entry: 1r6d (more details), 1.35 Å

PDB Description: crystal structure of desiv double mutant (dtdp-glucose 4,6- dehydratase) from streptomyces venezuelae with nad and dau bound
PDB Compounds: (A:) TDP-glucose-4,6-dehydratase

SCOPe Domain Sequences for d1r6da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]}
mrllvtggagfigshfvrqllagaypdvpadevivldsltyagnranlapvdadprlrfv
hgdirdagllarelrgvdaivhfaaeshvdrsiagasvftetnvqgtqtllqcavdagvg
rvvhvstnqvygsidsgswtessplepnspyaaskagsdlvarayhrtygldvritrccn
nygpyqhpekliplfvtnlldggtlplygdganvrewvhtddhcrgialvlaggrageiy
higggleltnreltgilldslgadwssvrkvadrkghdlrysldggkierelgyrpqvsf
adglartvrwyrenrgwweplk

SCOPe Domain Coordinates for d1r6da_:

Click to download the PDB-style file with coordinates for d1r6da_.
(The format of our PDB-style files is described here.)

Timeline for d1r6da_: