Lineage for d1r3ea1 (1r3e A:238-318)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.122: PUA domain-like [88696] (1 superfamily)
pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each otherSuperfamily b.122.1: PUA domain-like [88697] (15 families) 
Family b.122.1.1: PUA domain [88698] (6 proteins)
RNA-binding domain
Protein Pseudouridine synthase II TruB, C-terminal domain [88699] (5 species) 
Species Thermotoga maritima [TaxId:2336] [102023] (4 PDB entries) 
Domain d1r3ea1: 1r3e A:238-318 [96907]
Other proteins in same PDB: d1r3ea2
protein/RNA complex
Details for d1r3ea1
PDB Entry: 1r3e (more details), 2.1 Å
PDB Description: crystal structure of trna pseudouridine synthase trub and its rna complex: rna-protein recognition through a combination of rigid docking and induced fit
PDB Compounds: (A:) tRNA pseudouridine synthase BSCOPe Domain Sequences for d1r3ea1:
Sequence, based on SEQRES records: (download)
>d1r3ea1 b.122.1.1 (A:238-318) Pseudouridine synthase II TruB, C-terminal domain {Thermotoga maritima [TaxId: 2336]}
lprvvvhqestkmilngsqihlemlkewdgfkkgevvrvfneegrllalaeaernssfle
tlrkhernervltlrkvfntr
Sequence, based on observed residues (ATOM records): (download)
>d1r3ea1 b.122.1.1 (A:238-318) Pseudouridine synthase II TruB, C-terminal domain {Thermotoga maritima [TaxId: 2336]}
lprvvvhqestkmilngsqihlemlkewdgfkkgevvrvfneegrllalaeaernssfle
tlrkervltlrkvfntr
SCOPe Domain Coordinates for d1r3ea1:
Click to download the PDB-style file with coordinates for d1r3ea1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1r3ea1:
- d1r3ea1 first appeared in SCOP 1.67
- d1r3ea1 appears in SCOPe 2.07
View in 3D
