PDB entry 1r3e

View 1r3e on RCSB PDB site
Description: Crystal Structure of tRNA Pseudouridine Synthase TruB and Its RNA Complex: RNA-protein Recognition Through a Combination of Rigid Docking and Induced Fit
Class: lyase/RNA
Keywords: RNA modification, pseudouridylation, LYASE-RNA COMPLEX
Deposited on 2003-10-01, released 2003-11-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-02-07, with a file datestamp of 2018-02-02.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tRNA pseudouridine synthase B
    Species: Thermotoga maritima [TaxId:2336]
    Gene: truB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1r3ea1, d1r3ea2
  • Chain 'C':
    Compound: 5'-r(*cp*up*gp*up*gp*up*(fhu)p*cp*gp*ap*up*cp*cp*ap*cp*ap*g)-3'
  • Chain 'D':
    Compound: 5'-r(*cp*up*gp*up*gp*up*up*cp*gp*ap*up*cp*cp*ap*cp*ap*g)-3'
  • Chain 'E':
    Compound: 5'-r(*cp*up*gp*up*gp*up*up*cp*gp*ap*up*cp*cp*ap*cp*ap*g)-3'
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r3eA (A:)
    mkhgilvaykpkgptshdvvdevrkklktrkvghggtldpfacgvliigvnqgtrilefy
    kdlkkvywvkmrlglitetfditgevveerecnvteeeireaifsfvgeydqvppaysak
    kykgerlyklaregkiinlppkrvkifkiwdvniegrdvsfrvevspgtyirslcmdigy
    klgcgatavelvresvgphtieeslnvfeaapeeienriiplekclewlprvvvhqestk
    milngsqihlemlkewdgfkkgevvrvfneegrllalaeaernssfletlrkhernervl
    tlrkvfntr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r3eA (A:)
    mkhgilvaykpkgptshdvvdevrkklktrkvghggtldpfacgvliigvnqgtrilefy
    kdlkkvywvkmrlglitetfditgevveerecnvteeeireaifsfvgeydqvppaysak
    kykgerlyklaregkiinlppkrvkifkiwdvniegrdvsfrvevspgtyirslcmdigy
    klgcgatavelvresvgphtieeslnvfeaapeeienriiplekclewlprvvvhqestk
    milngsqihlemlkewdgfkkgevvrvfneegrllalaeaernssfletlrkervltlrk
    vfntr
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.