SCOP 1.67: Domain d1r3ea1: 1r3e A:238-318

Lineage for d1r3ea1 (1r3e A:238-318)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.122: PUA domain-like [88696] (1 superfamily)
   pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other

4. Superfamily b.122.1: PUA domain-like [88697] (3 families)

5. Family b.122.1.1: PUA domain [88698] (3 proteins)
   RNA-binding domain

6. Protein Pseudouridine synthase II TruB, C-terminal domain [88699] (3 species)

7. Species Thermotoga maritima [TaxId:243274] [102023] (1 PDB entry)

8. Domain d1r3ea1: 1r3e A:238-318 [96907]
   Other proteins in same PDB: d1r3ea2
   complexed with fhu

Details for d1r3ea1

PDB Entry: 1r3e, 2.1 Å

PDB Description: crystal structure of trna pseudouridine synthase trub and its rna complex: rna-protein recognition through a combination of rigid docking and induced fit

SCOP Domain Sequences for d1r3ea1:

Sequence, based on SEQRES records:

>d1r3ea1 b.122.1.1 (A:238-318) Pseudouridine synthase II TruB, C-terminal domain {Thermotoga maritima}
lprvvvhqestkmilngsqihlemlkewdgfkkgevvrvfneegrllalaeaernssfle
tlrkhernervltlrkvfntr

Sequence, based on observed residues (ATOM records):

>d1r3ea1 b.122.1.1 (A:238-318) Pseudouridine synthase II TruB, C-terminal domain {Thermotoga maritima}
lprvvvhqestkmilngsqihlemlkewdgfkkgevvrvfneegrllalaeaernssfle
tlrkervltlrkvfntr

Timeline for d1r3ea1:

• d1r3ea1 is new in SCOP 1.67
  
• d1r3ea1 appears in SCOP 1.69
  
• d1r3ea1 appears in the current release, SCOPe 2.08