Lineage for d1qkrb_ (1qkr B:)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
Superfamily a.24.9: alpha-catenin/vinculin-like [47220] (2 families) 
Family a.24.9.1: alpha-catenin/vinculin [47221] (3 proteins)
possible duplication: contains several domains of this fold
The listed PDB entries contain different large fragments but not the whole proteins
Protein Vinculin [47224] (2 species) Species Chicken (Gallus gallus) [TaxId:9031] [47225] (3 PDB entries)
Uniprot P12003
Domain d1qkrb_: 1qkr B: [16629]
tail domain
complexed with so4
Details for d1qkrb_
PDB Entry: 1qkr (more details), 1.8 Å
PDB Description: crystal structure of the vinculin tail and a pathway for activation
PDB Compounds: (B:) vinculinSCOPe Domain Sequences for d1qkrb_:
Sequence, based on SEQRES records: (download)
>d1qkrb_ a.24.9.1 (B:) Vinculin {Chicken (Gallus gallus) [TaxId: 9031]}
ekdeefpeqkageainqpmmmaarqlhdearkwsskgndiiaaakrmallmaemsrlvrg
gsgnkraliqcakdiakasdevtrlakevakqctdkrirtnllqvceriptistqlkils
tvkatmlgrtnisdeeseqatemlvhnaqnlmqsvketvreaeaasikirtdagftlrwv
rktpw
Sequence, based on observed residues (ATOM records): (download)
>d1qkrb_ a.24.9.1 (B:) Vinculin {Chicken (Gallus gallus) [TaxId: 9031]}
ekdeefpeqkageainqpmmmaarqlhdearkwsskgndiiaaakrmallmaemsrlvrg
gsgnkraliqcakdiakasdevtrlakevakqctdkrirtnllqvceriptistqlkils
tvkatmlgrtnisdeeseqatemlvhnaqnlmqsvketvreaeaasiagftlrwvrktpw
SCOPe Domain Coordinates for d1qkrb_:
Click to download the PDB-style file with coordinates for d1qkrb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qkrb_:
- d1qkrb_ first appeared (with stable ids) in SCOP 1.55
- d1qkrb_ appears in SCOPe 2.07
View in 3D
