![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
![]() | Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins) |
![]() | Protein 3C cysteine protease (picornain 3C) [50604] (9 species) |
![]() | Species Human hepatitis A virus [TaxId:208726] [50606] (5 PDB entries) |
![]() | Domain d1qa7b_: 1qa7 B: [26426] complexed with dms, gol, ivf |
PDB Entry: 1qa7 (more details), 1.9 Å
SCOPe Domain Sequences for d1qa7b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qa7b_ b.47.1.4 (B:) 3C cysteine protease (picornain 3C) {Human hepatitis A virus [TaxId: 208726]} stleiaglvrknlvqfgvgekngsvrwvmnalgvkddwllvpshaykfekdyemmefyfn rggtyysisagnvviqsldvgaqdvvlmkvptipkfrditqhfikkgdvpralnrlatlv ttvngtpmlisegplkmeekatyvhkkndgttvdltvdqawrgkgeglpgmcggalvssn qsiqnailgihvaggnsilvaklvtqemfqnidkkie
Timeline for d1qa7b_: