PDB entry 1qa7

View 1qa7 on RCSB PDB site
Description: crystal complex of the 3c proteinase from hepatitis a virus with its inhibitor and implications for the polyprotein processing in hav
Class: hydrolase/hydrolase inhibitor
Keywords: CHYMOTRYPSIN-LIKE CYSTEINE PROTEINASE VIRAL PROTEASE P'-SITE INHIBITOR, HYDROLASE, hydrolase-hydrolase inhibitor complex
Deposited on 1999-04-15, released 1999-04-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-05-16, with a file datestamp of 2012-05-11.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.214
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hav 3c proteinase
    Species: Hepatitis A virus [TaxId:12092]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26582 (0-End)
      • engineered (23)
      • engineered (81)
      • conflict (100)
    Domains in SCOPe 2.08: d1qa7a_
  • Chain 'B':
    Compound: hav 3c proteinase
    Species: Hepatitis A virus [TaxId:12092]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26582 (0-216)
      • engineered (23)
      • engineered (81)
      • conflict (100)
    Domains in SCOPe 2.08: d1qa7b_
  • Chain 'C':
    Compound: hav 3c proteinase
    Species: Hepatitis A virus [TaxId:12092]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26582 (0-End)
      • engineered (23)
      • engineered (81)
      • conflict (100)
    Domains in SCOPe 2.08: d1qa7c_
  • Chain 'D':
    Compound: hav 3c proteinase
    Species: Hepatitis A virus [TaxId:12092]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26582 (0-216)
      • engineered (23)
      • engineered (81)
      • conflict (100)
    Domains in SCOPe 2.08: d1qa7d_
  • Heterogens: IVF, DMS, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qa7A (A:)
    stleiaglvrknlvqfgvgekngsvrwvmnalgvkddwllvpshaykfekdyemmefyfn
    rggtyysisagnvviqsldvgaqdvvlmkvptipkfrditqhfikkgdvpralnrlatlv
    ttvngtpmlisegplkmeekatyvhkkndgttvdltvdqawrgkgeglpgmcggalvssn
    qsiqnailgihvaggnsilvaklvtqemfqnidkkie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qa7A (A:)
    stleiaglvrknlvqfgvgekngsvrwvmnalgvkddwllvpshaykfekdyemmefyfn
    rggtyysisagnvviqsldvgaqdvvlmkvptipkfrditqhfikkgdvpralnrlatlv
    ttvngtpmlisegplkmeekatyvhkkndgttvdltvdqawrgkgeglpgmcggalvssn
    qsiqnailgihvaggnsilvaklvtqemfqnid
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qa7B (B:)
    stleiaglvrknlvqfgvgekngsvrwvmnalgvkddwllvpshaykfekdyemmefyfn
    rggtyysisagnvviqsldvgaqdvvlmkvptipkfrditqhfikkgdvpralnrlatlv
    ttvngtpmlisegplkmeekatyvhkkndgttvdltvdqawrgkgeglpgmcggalvssn
    qsiqnailgihvaggnsilvaklvtqemfqnidkkie
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1qa7C (C:)
    stleiaglvrknlvqfgvgekngsvrwvmnalgvkddwllvpshaykfekdyemmefyfn
    rggtyysisagnvviqsldvgaqdvvlmkvptipkfrditqhfikkgdvpralnrlatlv
    ttvngtpmlisegplkmeekatyvhkkndgttvdltvdqawrgkgeglpgmcggalvssn
    qsiqnailgihvaggnsilvaklvtqemfqnidkkie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qa7C (C:)
    stleiaglvrknlvqfgvgekngsvrwvmnalgvkddwllvpshaykfekdyemmefyfn
    rggtyysisagnvviqsldvgaqdvvlmkvptipkfrditqhfikkgdvpralnrlatlv
    ttvngtpmlisegplkmeekatyvhkkndgttvdltvdqawrgkgeglpgmcggalvssn
    qsiqnailgihvaggnsilvaklvtqemfqnid
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qa7D (D:)
    stleiaglvrknlvqfgvgekngsvrwvmnalgvkddwllvpshaykfekdyemmefyfn
    rggtyysisagnvviqsldvgaqdvvlmkvptipkfrditqhfikkgdvpralnrlatlv
    ttvngtpmlisegplkmeekatyvhkkndgttvdltvdqawrgkgeglpgmcggalvssn
    qsiqnailgihvaggnsilvaklvtqemfqnidkkie