Lineage for d1pg5a2 (1pg5 A:147-299)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.78: ATC-like [53670] (2 superfamilies)
consists of two similar domains related by pseudo dyad; duplication
core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) 
Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins) 
Protein Aspartate carbamoyltransferase catalytic subunit [53673] (7 species) 
Species Sulfolobus acidocaldarius [TaxId:2285] [110719] (2 PDB entries)
Uniprot Q55338
Domain d1pg5a2: 1pg5 A:147-299 [104147]
Other proteins in same PDB: d1pg5b1, d1pg5b2
complexed with zn
Details for d1pg5a2
PDB Entry: 1pg5 (more details), 2.6 Å
PDB Description: crystal structure of the unligated (t-state) aspartate transcarbamoylase from the extremely thermophilic archaeon sulfolobus acidocaldarius
PDB Compounds: (A:) aspartate carbamoyltransferaseSCOPe Domain Sequences for d1pg5a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pg5a2 c.78.1.1 (A:147-299) Aspartate carbamoyltransferase catalytic subunit {Sulfolobus acidocaldarius [TaxId: 2285]}
idglvfallgdlkyartvnsllriltrfrpklvylispqllrarkeildelnypvkeven
pfevinevdvlyvtriqkerfvdemeyekikgsyivsldlankmkkdsiilhplprvnei
drkvdkttkakyfeqasygvpvrmsiltkiyge
SCOPe Domain Coordinates for d1pg5a2:
Click to download the PDB-style file with coordinates for d1pg5a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1pg5a2:
- d1pg5a2 first appeared in SCOP 1.69
- d1pg5a2 appears in SCOPe 2.06
- d1pg5a2 appears in the current release, SCOPe 2.08
View in 3D
