SCOP 1.69: Domain d1pg5a2: 1pg5 A:147-299

Lineage for d1pg5a2 (1pg5 A:147-299)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (1 family)

5. Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (3 proteins)

6. Protein Aspartate carbamoyltransferase catalytic subunit [53673] (4 species)

7. Species Archaeon Sulfolobus acidocaldarius [TaxId:2285] [110719] (1 PDB entry)

8. Domain d1pg5a2: 1pg5 A:147-299 [104147]
   Other proteins in same PDB: d1pg5b1, d1pg5b2

Details for d1pg5a2

PDB Entry: 1pg5, 2.6 Å

PDB Description: crystal structure of the unligated (t-state) aspartate transcarbamoylase from the extremely thermophilic archaeon sulfolobus acidocaldarius

SCOP Domain Sequences for d1pg5a2:

Sequence; same for both SEQRES and ATOM records:

>d1pg5a2 c.78.1.1 (A:147-299) Aspartate carbamoyltransferase catalytic subunit {Archaeon Sulfolobus acidocaldarius}
idglvfallgdlkyartvnsllriltrfrpklvylispqllrarkeildelnypvkeven
pfevinevdvlyvtriqkerfvdemeyekikgsyivsldlankmkkdsiilhplprvnei
drkvdkttkakyfeqasygvpvrmsiltkiyge

Timeline for d1pg5a2:

• d1pg5a2 is new in SCOP 1.69
  
• d1pg5a2 appears in SCOP 1.71
  
• d1pg5a2 appears in the current release, SCOPe 2.08