PDB entry 1pg5

View 1pg5 on RCSB PDB site
Description: crystal structure of the unligated (t-state) aspartate transcarbamoylase from the extremely thermophilic archaeon sulfolobus acidocaldarius
Class: transferase
Keywords: transferase
Deposited on 2003-05-27, released 2004-06-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.195
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aspartate carbamoyltransferase
    Species: Sulfolobus acidocaldarius [TaxId:2285]
    Gene: pyrB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q55338 (0-298)
      • see remark 999 (0)
    Domains in SCOPe 2.07: d1pg5a1, d1pg5a2
  • Chain 'B':
    Compound: Aspartate carbamoyltransferase regulatory chain
    Species: Sulfolobus acidocaldarius [TaxId:2285]
    Gene: pyrI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pg5b1, d1pg5b2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pg5A (A:)
    lkhiisaynfsrdeledifaltdkysknlndtrkilsgktisiaffepstrtylsfqkai
    inlggdvigfsgeestsvakgenladtirmlnnysdgivmrhkydgasrfaseisdipvi
    nagdgkhehptqavidiytinkhfntidglvfallgdlkyartvnsllriltrfrpklvy
    lispqllrarkeildelnypvkevenpfevinevdvlyvtriqkerfvdemeyekikgsy
    ivsldlankmkkdsiilhplprvneidrkvdkttkakyfeqasygvpvrmsiltkiyge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pg5A (A:)
    lkhiisaynfsrdeledifaltdkysknlndtrkilsgktisiaffepstrtylsfqkai
    inlggdvigfsgegenladtirmlnnysdgivmrhkydgasrfaseisdipvinagdgkh
    ehptqavidiytinkhfntidglvfallgdlkyartvnsllriltrfrpklvylispqll
    rarkeildelnypvkevenpfevinevdvlyvtriqkerfvdemeyekikgsyivsldla
    nkmkkdsiilhplprvneidrkvdkttkakyfeqasygvpvrmsiltkiyge
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pg5B (B:)
    mefmmeiqgnrkelmvskikngtvidhipagrafavlnvlgikghegfrialvinvdskk
    mgkkdivkiedkeisdteanlitliaptatinivreyevvkktklevpkvvkgilkcpnp
    ycitsndveaiptfktltekplkmrceycetiideneimsqilgannk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pg5B (B:)
    mvskikngtvidhipagrafavlnvlgikegfrialvinvdskkmgkkdivkiedkeisd
    teanlitliaptatinivreyevvkktklevpkvvkgilkcpnpycitsndveaiptfkt
    ltekplkmrceycetiideneimsqilg