Lineage for d1nt0a1 (1nt0 A:5-119)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387375Fold b.23: CUB-like [49853] (3 superfamilies)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2387376Superfamily b.23.1: Spermadhesin, CUB domain [49854] (2 families) (S)
    automatically mapped to Pfam PF00431
  5. 2387377Family b.23.1.1: Spermadhesin, CUB domain [49855] (6 proteins)
  6. 2387401Protein Mannose-binding protein associated serine protease 2, MASP2 [89256] (2 species)
    duplication: contains two CUB domains separated by an EGF-like domain
  7. 2387406Species Norway rat (Rattus norvegicus) [TaxId:10116] [89257] (1 PDB entry)
  8. 2387407Domain d1nt0a1: 1nt0 A:5-119 [86143]
    Other proteins in same PDB: d1nt0a3, d1nt0g3
    complexed with ca, edo, nag

Details for d1nt0a1

PDB Entry: 1nt0 (more details), 2.7 Å

PDB Description: crystal structure of the cub1-egf-cub2 region of masp2
PDB Compounds: (A:) mannose-binding protein associated serine protease-2

SCOPe Domain Sequences for d1nt0a1:

Sequence, based on SEQRES records: (download)

>d1nt0a1 b.23.1.1 (A:5-119) Mannose-binding protein associated serine protease 2, MASP2 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
epvfgrlvspgfpekygnhqdrswtltappgfrlrlyfthfnlelsyrceydfvkltsgt
kvlatlcgqestdterapgndtfyslgpslkvtfhsdysnekpftgfeafyaaed

Sequence, based on observed residues (ATOM records): (download)

>d1nt0a1 b.23.1.1 (A:5-119) Mannose-binding protein associated serine protease 2, MASP2 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
epvfgrlvspgfpekygnhqdrswtltappgfrlrlyfthfnlelsyrceydfvkltsgt
kvlatlcgqestdterapgndtfyslgpslkvtfhsdypftgfeafyaaed

SCOPe Domain Coordinates for d1nt0a1:

Click to download the PDB-style file with coordinates for d1nt0a1.
(The format of our PDB-style files is described here.)

Timeline for d1nt0a1: