![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.23: CUB-like [49853] (3 superfamilies) sandwich, 10 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.23.1: Spermadhesin, CUB domain [49854] (2 families) ![]() automatically mapped to Pfam PF00431 |
![]() | Family b.23.1.1: Spermadhesin, CUB domain [49855] (6 proteins) |
![]() | Protein Mannose-binding protein associated serine protease 2, MASP2 [89256] (2 species) duplication: contains two CUB domains separated by an EGF-like domain |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [89257] (1 PDB entry) |
![]() | Domain d1nt0a2: 1nt0 A:165-278 [86144] Other proteins in same PDB: d1nt0a3, d1nt0g3 complexed with ca, edo, nag |
PDB Entry: 1nt0 (more details), 2.7 Å
SCOPe Domain Sequences for d1nt0a2:
Sequence, based on SEQRES records: (download)
>d1nt0a2 b.23.1.1 (A:165-278) Mannose-binding protein associated serine protease 2, MASP2 {Norway rat (Rattus norvegicus) [TaxId: 10116]} csgqvftgrsgflsspeypqpypklsscaynirleegfsitldfvesfdvemhpeaqcpy dslkiqtdkreygpfcgktlpprietdsnkvtitfttdesgnhtgwkihytsta
>d1nt0a2 b.23.1.1 (A:165-278) Mannose-binding protein associated serine protease 2, MASP2 {Norway rat (Rattus norvegicus) [TaxId: 10116]} csgqvftgrsgflsspeypqpypklsscaynirleegfsitldfvesfdvemhcdslkiq tdkreygpfcgktlpprietdsnkvtitfttdesgnhtgwkihytsta
Timeline for d1nt0a2: