Lineage for d1nt0g3 (1nt0 G:120-164)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2634700Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2635893Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 2635894Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 2636268Protein Mannose-binding protein associated serine protease 2, MASP2 [90141] (2 species)
    EGF-like domain separates two CUB domains
  7. 2636272Species Norway rat (Rattus norvegicus) [TaxId:10116] [90142] (1 PDB entry)
  8. 2636274Domain d1nt0g3: 1nt0 G:120-164 [86148]
    Other proteins in same PDB: d1nt0a1, d1nt0a2, d1nt0g1, d1nt0g2
    complexed with ca, edo, nag

Details for d1nt0g3

PDB Entry: 1nt0 (more details), 2.7 Å

PDB Description: crystal structure of the cub1-egf-cub2 region of masp2
PDB Compounds: (G:) mannose-binding protein associated serine protease-2

SCOPe Domain Sequences for d1nt0g3:

Sequence, based on SEQRES records: (download)

>d1nt0g3 g.3.11.1 (G:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
vdecrtslgdsvpcdhychnylggyycscrvgyilhqnkhtcsal

Sequence, based on observed residues (ATOM records): (download)

>d1nt0g3 g.3.11.1 (G:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
vdecrpcdhychnylggyycscrvgyilhqnkhtcsal

SCOPe Domain Coordinates for d1nt0g3:

Click to download the PDB-style file with coordinates for d1nt0g3.
(The format of our PDB-style files is described here.)

Timeline for d1nt0g3: