PDB entry 1nt0

View 1nt0 on RCSB PDB site
Description: Crystal structure of the CUB1-EGF-CUB2 region of MASP2
Class: hydrolase, sugar binding protein
Keywords: mannose-binding protein, MASP, CUB domain, EGF like domain., HYDROLASE, SUGAR BINDING PROTEIN
Deposited on 2003-01-28, released 2003-05-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mannose-binding protein associated serine protease-2
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9JJS8
      • modified residue (138)
    Domains in SCOPe 2.07: d1nt0a1, d1nt0a2, d1nt0a3
  • Chain 'G':
    Compound: mannose-binding protein associated serine protease-2
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9JJS8
      • modified residue (138)
    Domains in SCOPe 2.07: d1nt0g1, d1nt0g2, d1nt0g3
  • Heterogens: NAG, CA, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nt0A (A:)
    skwpepvfgrlvspgfpekygnhqdrswtltappgfrlrlyfthfnlelsyrceydfvkl
    tsgtkvlatlcgqestdterapgndtfyslgpslkvtfhsdysnekpftgfeafyaaedv
    decrtslgdsvpcdhychnylggyycscrvgyilhqnkhtcsalcsgqvftgrsgflssp
    eypqpypklsscaynirleegfsitldfvesfdvemhpeaqcpydslkiqtdkreygpfc
    gktlpprietdsnkvtitfttdesgnhtgwkihytstaqphhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nt0A (A:)
    epvfgrlvspgfpekygnhqdrswtltappgfrlrlyfthfnlelsyrceydfvkltsgt
    kvlatlcgqestdterapgndtfyslgpslkvtfhsdypftgfeafyaaedvdecrpcdh
    ychnylggyycscrvgyilhqnkhtcsalcsgqvftgrsgflsspeypqpypklsscayn
    irleegfsitldfvesfdvemhcdslkiqtdkreygpfcgktlpprietdsnkvtitftt
    desgnhtgwkihytsta
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1nt0G (G:)
    skwpepvfgrlvspgfpekygnhqdrswtltappgfrlrlyfthfnlelsyrceydfvkl
    tsgtkvlatlcgqestdterapgndtfyslgpslkvtfhsdysnekpftgfeafyaaedv
    decrtslgdsvpcdhychnylggyycscrvgyilhqnkhtcsalcsgqvftgrsgflssp
    eypqpypklsscaynirleegfsitldfvesfdvemhpeaqcpydslkiqtdkreygpfc
    gktlpprietdsnkvtitfttdesgnhtgwkihytstaqphhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nt0G (G:)
    epvfgrlvspgfpekygnhqdrswtltappgfrlrlyfthfnlelsyrceydfvkltsgt
    kvlatlcgqestdterapgndtfyslgpslkvtfhsdypftgfeafyaaedvdecrpcdh
    ychnylggyycscrvgyilhqnkhtcsalcsgqvftgrsgflsspeypqpypklsscayn
    irleegfsitldfvesfdvemhcdslkiqtdkreygpfcgktlpprietdsnkvtitftt
    desgnhtgwkihytsta