Lineage for d1n27a_ (1n27 A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1535986Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1537363Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) (S)
  5. 1537450Family b.34.9.2: PWWP domain [69250] (6 proteins)
    includes the C-terminal all-alpha subdomain
  6. 1537461Protein Hepatoma-derived growth factor, related protein 3 [101684] (1 species)
  7. 1537462Species Mouse (Mus musculus) [TaxId:10090] [101685] (1 PDB entry)
  8. 1537463Domain d1n27a_: 1n27 A: [91549]

Details for d1n27a_

PDB Entry: 1n27 (more details)

PDB Description: solution structure of the pwwp domain of mouse hepatoma-derived growth factor, related protein 3
PDB Compounds: (A:) Hepatoma-derived growth factor, related protein 3

SCOPe Domain Sequences for d1n27a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n27a_ b.34.9.2 (A:) Hepatoma-derived growth factor, related protein 3 {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgeykagdlvfakmkgyphwparidelpegavkppankypifffgthetaflgpk
dlfpykeykdkfgksnkrkgfneglweiensgpssg

SCOPe Domain Coordinates for d1n27a_:

Click to download the PDB-style file with coordinates for d1n27a_.
(The format of our PDB-style files is described here.)

Timeline for d1n27a_: