| Class b: All beta proteins [48724] (176 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) ![]() |
| Family b.34.9.2: PWWP domain [69250] (6 proteins) includes the C-terminal all-alpha subdomain |
| Protein Hepatoma-derived growth factor, related protein 3 [101684] (1 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [101685] (1 PDB entry) |
| Domain d1n27a_: 1n27 A: [91549] |
PDB Entry: 1n27 (more details)
SCOPe Domain Sequences for d1n27a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n27a_ b.34.9.2 (A:) Hepatoma-derived growth factor, related protein 3 {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgeykagdlvfakmkgyphwparidelpegavkppankypifffgthetaflgpk
dlfpykeykdkfgksnkrkgfneglweiensgpssg
Timeline for d1n27a_: