Lineage for d1n27a_ (1n27 A:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 372425Fold b.34: SH3-like barrel [50036] (15 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 372967Superfamily b.34.9: Tudor/PWWP/MBT [63748] (3 families) (S)
  5. 372973Family b.34.9.2: PWWP domain [69250] (3 proteins)
    includes the C-terminal all-alpha subdomain
  6. 372977Protein Hepatoma-derived growth factor, related protein 3 [101684] (1 species)
  7. 372978Species Mouse (Mus musculus) [TaxId:10090] [101685] (1 PDB entry)
  8. 372979Domain d1n27a_: 1n27 A: [91549]

Details for d1n27a_

PDB Entry: 1n27 (more details)

PDB Description: Solution structure of the PWWP domain of mouse Hepatoma-derived growth factor, related protein 3

SCOP Domain Sequences for d1n27a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n27a_ b.34.9.2 (A:) Hepatoma-derived growth factor, related protein 3 {Mouse (Mus musculus)}
gssgssgeykagdlvfakmkgyphwparidelpegavkppankypifffgthetaflgpk
dlfpykeykdkfgksnkrkgfneglweiensgpssg

SCOP Domain Coordinates for d1n27a_:

Click to download the PDB-style file with coordinates for d1n27a_.
(The format of our PDB-style files is described here.)

Timeline for d1n27a_: