PDB entry 1n27

View 1n27 on RCSB PDB site
Description: Solution structure of the PWWP domain of mouse Hepatoma-derived growth factor, related protein 3
Class: hormone/growth factor
Keywords: Nuclear translocation, HDGF family, hath, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, HORMONE/GROWTH FACTOR COMPLEX
Deposited on 2002-10-22, released 2003-12-23
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hepatoma-derived growth factor, related protein 3
    Species: Mus musculus [TaxId:10090]
    Gene: 4632410H03
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9JMG7 (7-89)
      • cloning artifact (0-6)
      • cloning artifact (90-95)
    Domains in SCOPe 2.04: d1n27a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n27A (A:)
    gssgssgeykagdlvfakmkgyphwparidelpegavkppankypifffgthetaflgpk
    dlfpykeykdkfgksnkrkgfneglweiensgpssg