![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) ![]() |
![]() | Family b.34.9.2: PWWP domain [69250] (6 proteins) includes the C-terminal all-alpha subdomain |
![]() | Protein Hepatoma-derived growth factor, related protein 3 [101684] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [101685] (1 PDB entry) |
![]() | Domain d1n27a1: 1n27 A:8-90 [91549] Other proteins in same PDB: d1n27a2, d1n27a3 |
PDB Entry: 1n27 (more details)
SCOPe Domain Sequences for d1n27a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n27a1 b.34.9.2 (A:8-90) Hepatoma-derived growth factor, related protein 3 {Mouse (Mus musculus) [TaxId: 10090]} eykagdlvfakmkgyphwparidelpegavkppankypifffgthetaflgpkdlfpyke ykdkfgksnkrkgfneglweien
Timeline for d1n27a1: