Lineage for d1mcza1 (1mcz A:182-341)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1591787Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 1591788Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 1591815Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (8 proteins)
    N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold
  6. 1591839Protein Benzoylformate decarboxylase [52482] (1 species)
  7. 1591840Species Pseudomonas putida [TaxId:303] [52483] (34 PDB entries)
    Uniprot P20906
  8. 1591895Domain d1mcza1: 1mcz A:182-341 [78952]
    Other proteins in same PDB: d1mcza2, d1mcza3, d1mczb2, d1mczb3, d1mczc2, d1mczc3, d1mczd2, d1mczd3, d1mcze2, d1mcze3, d1mczf2, d1mczf3, d1mczg2, d1mczg3, d1mczh2, d1mczh3, d1mczi2, d1mczi3, d1mczj2, d1mczj3, d1mczk2, d1mczk3, d1mczl2, d1mczl3, d1mczm2, d1mczm3, d1mczn2, d1mczn3, d1mczo2, d1mczo3, d1mczp2, d1mczp3
    complexed with mg, rmn, tdp

Details for d1mcza1

PDB Entry: 1mcz (more details), 2.8 Å

PDB Description: benzoylformate decarboxylase from pseudomonas putida complexed with an inhibitor, r-mandelate
PDB Compounds: (A:) Benzoylformate decarboxylase

SCOPe Domain Sequences for d1mcza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mcza1 c.31.1.3 (A:182-341) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]}
svrlndqdldilvkalnsasnpaivlgpdvdaananadcvmlaerlkapvwvapsaprcp
fptrhpcfrglmpagiaaisqlleghdvvlvigapvfryhqydpgqylkpgtrlisvtcd
pleaarapmgdaivadigamasalanlveessrqlptaap

SCOPe Domain Coordinates for d1mcza1:

Click to download the PDB-style file with coordinates for d1mcza1.
(The format of our PDB-style files is described here.)

Timeline for d1mcza1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1mczb1, d1mczb2, d1mczb3, d1mczc1, d1mczc2, d1mczc3, d1mczd1, d1mczd2, d1mczd3, d1mcze1, d1mcze2, d1mcze3, d1mczf1, d1mczf2, d1mczf3, d1mczg1, d1mczg2, d1mczg3, d1mczh1, d1mczh2, d1mczh3, d1mczi1, d1mczi2, d1mczi3, d1mczj1, d1mczj2, d1mczj3, d1mczk1, d1mczk2, d1mczk3, d1mczl1, d1mczl2, d1mczl3, d1mczm1, d1mczm2, d1mczm3, d1mczn1, d1mczn2, d1mczn3, d1mczo1, d1mczo2, d1mczo3, d1mczp1, d1mczp2, d1mczp3