| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) ![]() there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
| Family c.36.1.9: Pyruvate oxidase and decarboxylase PP module [88749] (8 proteins) the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpa/beta domain of Rossmann-like topology |
| Protein Benzoylformate decarboxylase [88756] (1 species) |
| Species Pseudomonas putida [TaxId:303] [88757] (7 PDB entries) Uniprot P20906 |
| Domain d1mczh3: 1mcz H:342-525 [78975] Other proteins in same PDB: d1mcza1, d1mcza2, d1mczb1, d1mczb2, d1mczc1, d1mczc2, d1mczd1, d1mczd2, d1mcze1, d1mcze2, d1mczf1, d1mczf2, d1mczg1, d1mczg2, d1mczh1, d1mczh2, d1mczi1, d1mczi2, d1mczj1, d1mczj2, d1mczk1, d1mczk2, d1mczl1, d1mczl2, d1mczm1, d1mczm2, d1mczn1, d1mczn2, d1mczo1, d1mczo2, d1mczp1, d1mczp2 complexed with mg, rmn, tdp |
PDB Entry: 1mcz (more details), 2.8 Å
SCOPe Domain Sequences for d1mczh3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mczh3 c.36.1.9 (H:342-525) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]}
epakvdqdagrlhpetvfdtlndmapenaiylneststtaqmwqrlnmrnpgsyyfcaag
glgfalpaaigvqlaeperqviavigdgsanysisalwtaaqyniptifvimnngtygal
rwfagvleaenvpgldvpgidfralakgygvqalkadnleqlkgslqealsakgpvliev
stvs
Timeline for d1mczh3:
View in 3DDomains from other chains: (mouse over for more information) d1mcza1, d1mcza2, d1mcza3, d1mczb1, d1mczb2, d1mczb3, d1mczc1, d1mczc2, d1mczc3, d1mczd1, d1mczd2, d1mczd3, d1mcze1, d1mcze2, d1mcze3, d1mczf1, d1mczf2, d1mczf3, d1mczg1, d1mczg2, d1mczg3, d1mczi1, d1mczi2, d1mczi3, d1mczj1, d1mczj2, d1mczj3, d1mczk1, d1mczk2, d1mczk3, d1mczl1, d1mczl2, d1mczl3, d1mczm1, d1mczm2, d1mczm3, d1mczn1, d1mczn2, d1mczn3, d1mczo1, d1mczo2, d1mczo3, d1mczp1, d1mczp2, d1mczp3 |