Lineage for d1mczl2 (1mcz L:2-181)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1592643Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 1592644Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 1592645Family c.36.1.5: Pyruvate oxidase and decarboxylase Pyr module [88724] (8 proteins)
    the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpha/beta domain of Rossmann-like topology
    automatically mapped to Pfam PF02776
  6. 1592669Protein Benzoylformate decarboxylase [88731] (1 species)
  7. 1592670Species Pseudomonas putida [TaxId:303] [88732] (7 PDB entries)
    Uniprot P20906
  8. 1592688Domain d1mczl2: 1mcz L:2-181 [78986]
    Other proteins in same PDB: d1mcza1, d1mcza3, d1mczb1, d1mczb3, d1mczc1, d1mczc3, d1mczd1, d1mczd3, d1mcze1, d1mcze3, d1mczf1, d1mczf3, d1mczg1, d1mczg3, d1mczh1, d1mczh3, d1mczi1, d1mczi3, d1mczj1, d1mczj3, d1mczk1, d1mczk3, d1mczl1, d1mczl3, d1mczm1, d1mczm3, d1mczn1, d1mczn3, d1mczo1, d1mczo3, d1mczp1, d1mczp3
    complexed with mg, rmn, tdp

Details for d1mczl2

PDB Entry: 1mcz (more details), 2.8 Å

PDB Description: benzoylformate decarboxylase from pseudomonas putida complexed with an inhibitor, r-mandelate
PDB Compounds: (L:) Benzoylformate decarboxylase

SCOPe Domain Sequences for d1mczl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mczl2 c.36.1.5 (L:2-181) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]}
asvhgttyellrrqgidtvfgnpgsnelpflkdfpedfryilalqeacvvgiadgyaqas
rkpafinlhsaagtgnamgalsnawnshsplivtagqqtramigvealltnvdaanlprp
lvkwsyepasaaevphamsraihmasmapqgpvylsvpyddwdkdadpqshhlfdrhvss

SCOPe Domain Coordinates for d1mczl2:

Click to download the PDB-style file with coordinates for d1mczl2.
(The format of our PDB-style files is described here.)

Timeline for d1mczl2:

View in 3D
Domains from other chains:
(mouse over for more information)
d1mcza1, d1mcza2, d1mcza3, d1mczb1, d1mczb2, d1mczb3, d1mczc1, d1mczc2, d1mczc3, d1mczd1, d1mczd2, d1mczd3, d1mcze1, d1mcze2, d1mcze3, d1mczf1, d1mczf2, d1mczf3, d1mczg1, d1mczg2, d1mczg3, d1mczh1, d1mczh2, d1mczh3, d1mczi1, d1mczi2, d1mczi3, d1mczj1, d1mczj2, d1mczj3, d1mczk1, d1mczk2, d1mczk3, d1mczm1, d1mczm2, d1mczm3, d1mczn1, d1mczn2, d1mczn3, d1mczo1, d1mczo2, d1mczo3, d1mczp1, d1mczp2, d1mczp3