Lineage for d1mczc3 (1mcz C:342-525)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1592643Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 1592644Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 1592920Family c.36.1.9: Pyruvate oxidase and decarboxylase PP module [88749] (8 proteins)
    the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpa/beta domain of Rossmann-like topology
  6. 1592944Protein Benzoylformate decarboxylase [88756] (1 species)
  7. 1592945Species Pseudomonas putida [TaxId:303] [88757] (7 PDB entries)
    Uniprot P20906
  8. 1592954Domain d1mczc3: 1mcz C:342-525 [78960]
    Other proteins in same PDB: d1mcza1, d1mcza2, d1mczb1, d1mczb2, d1mczc1, d1mczc2, d1mczd1, d1mczd2, d1mcze1, d1mcze2, d1mczf1, d1mczf2, d1mczg1, d1mczg2, d1mczh1, d1mczh2, d1mczi1, d1mczi2, d1mczj1, d1mczj2, d1mczk1, d1mczk2, d1mczl1, d1mczl2, d1mczm1, d1mczm2, d1mczn1, d1mczn2, d1mczo1, d1mczo2, d1mczp1, d1mczp2
    complexed with mg, rmn, tdp

Details for d1mczc3

PDB Entry: 1mcz (more details), 2.8 Å

PDB Description: benzoylformate decarboxylase from pseudomonas putida complexed with an inhibitor, r-mandelate
PDB Compounds: (C:) Benzoylformate decarboxylase

SCOPe Domain Sequences for d1mczc3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mczc3 c.36.1.9 (C:342-525) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]}
epakvdqdagrlhpetvfdtlndmapenaiylneststtaqmwqrlnmrnpgsyyfcaag
glgfalpaaigvqlaeperqviavigdgsanysisalwtaaqyniptifvimnngtygal
rwfagvleaenvpgldvpgidfralakgygvqalkadnleqlkgslqealsakgpvliev
stvs

SCOPe Domain Coordinates for d1mczc3:

Click to download the PDB-style file with coordinates for d1mczc3.
(The format of our PDB-style files is described here.)

Timeline for d1mczc3:

View in 3D
Domains from other chains:
(mouse over for more information)
d1mcza1, d1mcza2, d1mcza3, d1mczb1, d1mczb2, d1mczb3, d1mczd1, d1mczd2, d1mczd3, d1mcze1, d1mcze2, d1mcze3, d1mczf1, d1mczf2, d1mczf3, d1mczg1, d1mczg2, d1mczg3, d1mczh1, d1mczh2, d1mczh3, d1mczi1, d1mczi2, d1mczi3, d1mczj1, d1mczj2, d1mczj3, d1mczk1, d1mczk2, d1mczk3, d1mczl1, d1mczl2, d1mczl3, d1mczm1, d1mczm2, d1mczm3, d1mczn1, d1mczn2, d1mczn3, d1mczo1, d1mczo2, d1mczo3, d1mczp1, d1mczp2, d1mczp3