Lineage for d1e4ea2 (1e4e A:132-342)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.142: ATP-grasp [56058] (2 superfamilies)
Consists of two subdomains with different alpha+beta folds
shares functional and structural similarities with the PIPK and protein kinase superfamiliesSuperfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) 
Family d.142.1.1: ATP-binding domain of peptide synthetases [56060] (4 proteins) 
Protein D-alanine:D-lactate ligase VanA, C-domain [56065] (2 species) 
Species Enterococcus faecium [TaxId:1352] [64402] (1 PDB entry) 
Domain d1e4ea2: 1e4e A:132-342 [59222]
Other proteins in same PDB: d1e4ea1, d1e4eb1
complexed with adp, gol, mg, phy, so4
Details for d1e4ea2
PDB Entry: 1e4e (more details), 2.5 Å
PDB Description: d-alanyl-d-lacate ligase
PDB Compounds: (A:) vancomycin/teicoplanin a-type resistance protein vanaSCOPe Domain Sequences for d1e4ea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e4ea2 d.142.1.1 (A:132-342) D-alanine:D-lactate ligase VanA, C-domain {Enterococcus faecium [TaxId: 1352]}
dksltyivaknagiatpafwvinkddrpvaatftypvfvkparsgssfgvkkvnsadeld
yaiesarqydskilieqavsgcevgcavlgnsaalvvgevdqirlqygifrihqevepek
gsenavitvpadlsaeergriqetvkkiyktlgcrglarvdmflqdngrivlnevntlpg
ftsysryprmmaaagislpelidrlivlalk
SCOPe Domain Coordinates for d1e4ea2:
Click to download the PDB-style file with coordinates for d1e4ea2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1e4ea2:
- d1e4ea2 first appeared in SCOP 1.57
- d1e4ea2 appears in SCOPe 2.07
View in 3D
