Lineage for d1e4ea2 (1e4e A:132-342)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 84221Fold d.142: ATP-grasp [56058] (2 superfamilies)
  4. 84222Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (6 families) (S)
  5. 84223Family d.142.1.1: Peptide synthetases, C-terminal domain [56060] (3 proteins)
  6. 84229Protein D-alanine:D-lactate ligase, VanA [56065] (2 species)
  7. 84230Species Enterococcus faecium [TaxId:1352] [64402] (1 PDB entry)
  8. 84231Domain d1e4ea2: 1e4e A:132-342 [59222]
    Other proteins in same PDB: d1e4ea1, d1e4eb1

Details for d1e4ea2

PDB Entry: 1e4e (more details), 2.5 Å

PDB Description: d-alanyl-d-lacate ligase

SCOP Domain Sequences for d1e4ea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e4ea2 d.142.1.1 (A:132-342) D-alanine:D-lactate ligase, VanA {Enterococcus faecium}
dksltyivaknagiatpafwvinkddrpvaatftypvfvkparsgssfgvkkvnsadeld
yaiesarqydskilieqavsgcevgcavlgnsaalvvgevdqirlqygifrihqevepek
gsenavitvpadlsaeergriqetvkkiyktlgcrglarvdmflqdngrivlnevntlpg
ftsysryprmmaaagislpelidrlivlalk

SCOP Domain Coordinates for d1e4ea2:

Click to download the PDB-style file with coordinates for d1e4ea2.
(The format of our PDB-style files is described here.)

Timeline for d1e4ea2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e4ea1