PDB entry 1e4e

View 1e4e on RCSB PDB site
Description: D-alanyl-D-lacate ligase
Class: ligase
Keywords: ligase, cell wall, antibiotic resistance, membrane, peptidoglycan synthesis
Deposited on 2000-07-03, released 2001-06-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vancomycin/teicoplanin a-type resistance protein vana
    Species: ENTEROCOCCUS FAECIUM [TaxId:1352]
    Gene: VANA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25051
      • conflict (61)
      • conflict (275)
      • conflict (281)
      • conflict (327)
    Domains in SCOPe 2.07: d1e4ea1, d1e4ea2
  • Chain 'B':
    Compound: vancomycin/teicoplanin a-type resistance protein vana
    Species: ENTEROCOCCUS FAECIUM [TaxId:1352]
    Gene: VANA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25051
      • conflict (61)
      • conflict (275)
      • conflict (281)
      • conflict (297)
      • conflict (327)
    Domains in SCOPe 2.07: d1e4eb1, d1e4eb2
  • Heterogens: ADP, PHY, MG, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e4eA (A:)
    mnrikvailfggcseehdvsvksaieiaaninkekyeplyigitksgvwkmcekpcaewe
    nencysavlspdkkmhgllvkknheyeinhvdvafsalhgksgedgsiqglfelsgipfv
    gcdiqssaicmdksltyivaknagiatpafwvinkddrpvaatftypvfvkparsgssfg
    vkkvnsadeldyaiesarqydskilieqavsgcevgcavlgnsaalvvgevdqirlqygi
    frihqevepekgsenavitvpadlsaeergriqetvkkiyktlgcrglarvdmflqdngr
    ivlnevntlpgftsysryprmmaaagislpelidrlivlalkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e4eA (A:)
    nrikvailfggcseehdvsvksaieiaaninkekyeplyigitksgvwkmcekpcaewen
    encysavlspdkkmhgllvkknheyeinhvdvafsalhgksgedgsiqglfelsgipfvg
    cdiqssaicmdksltyivaknagiatpafwvinkddrpvaatftypvfvkparsgssfgv
    kkvnsadeldyaiesarqydskilieqavsgcevgcavlgnsaalvvgevdqirlqygif
    rihqevepekgsenavitvpadlsaeergriqetvkkiyktlgcrglarvdmflqdngri
    vlnevntlpgftsysryprmmaaagislpelidrlivlalk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1e4eB (B:)
    mnrikvailfggcseehdvsvksaieiaaninkekyeplyigitksgvwkmcekpcaewe
    nencysavlspdkkmhgllvkknheyeinhvdvafsalhgksgedgsiqglfelsgipfv
    gcdiqssaicmdksltyivaknagiatpafwvinkddrpvaatftypvfvkparsgssfg
    vkkvnsadeldyaiesarqydskilieqavsgcevgcavlgnsaalvvgevdqirlqygi
    frihqevepekgsenavitvpadlsaeergriqetvkkiyktlgcrglarvdmflqdrgr
    ivlnevntlpgftsysryprmmaaagislpelidrlivlalkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e4eB (B:)
    nrikvailfggcseehdvsvksaieiaaninkekyeplyigitksgvwkmcekpcaewen
    encysavlspdkkmhgllvkknheyeinhvdvafsalhgksgedgsiqglfelsgipfvg
    cdiqssaicmdksltyivaknagiatpafwvinkddrpvaatftypvfvkparsgssfgv
    kkvnsadeldyaiesarqydskilieqavsgcevgcavlgnsaalvvgevdqirlqygif
    rihqevepekgsenavitvpadlsaeergriqetvkkiyktlgcrglarvdmflqdrgri
    vlnevntlpgftsysryprmmaaagislpelidrlivlal