![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
![]() | Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) ![]() |
![]() | Family d.142.1.1: ATP-binding domain of peptide synthetases [56060] (4 proteins) |
![]() | Protein D-alanine:D-lactate ligase VanA, C-domain [56065] (2 species) |
![]() | Species Enterococcus faecium [TaxId:1352] [64402] (1 PDB entry) |
![]() | Domain d1e4eb2: 1e4e B:132-341 [59224] Other proteins in same PDB: d1e4ea1, d1e4eb1 complexed with adp, gol, mg, phy, so4 |
PDB Entry: 1e4e (more details), 2.5 Å
SCOPe Domain Sequences for d1e4eb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e4eb2 d.142.1.1 (B:132-341) D-alanine:D-lactate ligase VanA, C-domain {Enterococcus faecium [TaxId: 1352]} dksltyivaknagiatpafwvinkddrpvaatftypvfvkparsgssfgvkkvnsadeld yaiesarqydskilieqavsgcevgcavlgnsaalvvgevdqirlqygifrihqevepek gsenavitvpadlsaeergriqetvkkiyktlgcrglarvdmflqdrgrivlnevntlpg ftsysryprmmaaagislpelidrlivlal
Timeline for d1e4eb2: