Lineage for d1e4eb2 (1e4e B:132-341)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2541368Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2541369Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2541370Family d.142.1.1: ATP-binding domain of peptide synthetases [56060] (4 proteins)
  6. 2541376Protein D-alanine:D-lactate ligase VanA, C-domain [56065] (2 species)
  7. 2541377Species Enterococcus faecium [TaxId:1352] [64402] (1 PDB entry)
  8. 2541379Domain d1e4eb2: 1e4e B:132-341 [59224]
    Other proteins in same PDB: d1e4ea1, d1e4eb1
    complexed with adp, gol, mg, phy, so4

Details for d1e4eb2

PDB Entry: 1e4e (more details), 2.5 Å

PDB Description: d-alanyl-d-lacate ligase
PDB Compounds: (B:) vancomycin/teicoplanin a-type resistance protein vana

SCOPe Domain Sequences for d1e4eb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e4eb2 d.142.1.1 (B:132-341) D-alanine:D-lactate ligase VanA, C-domain {Enterococcus faecium [TaxId: 1352]}
dksltyivaknagiatpafwvinkddrpvaatftypvfvkparsgssfgvkkvnsadeld
yaiesarqydskilieqavsgcevgcavlgnsaalvvgevdqirlqygifrihqevepek
gsenavitvpadlsaeergriqetvkkiyktlgcrglarvdmflqdrgrivlnevntlpg
ftsysryprmmaaagislpelidrlivlal

SCOPe Domain Coordinates for d1e4eb2:

Click to download the PDB-style file with coordinates for d1e4eb2.
(The format of our PDB-style files is described here.)

Timeline for d1e4eb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e4eb1