![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
![]() | Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) ![]() precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
![]() | Family c.30.1.2: D-Alanine ligase N-terminal domain [52452] (2 proteins) |
![]() | Protein D-alanine:D-lactate ligase VanA, N-domain [52455] (2 species) |
![]() | Species Enterococcus faecium [TaxId:1352] [63983] (1 PDB entry) |
![]() | Domain d1e4eb1: 1e4e B:2-131 [59223] Other proteins in same PDB: d1e4ea2, d1e4eb2 complexed with adp, gol, mg, phy, so4 |
PDB Entry: 1e4e (more details), 2.5 Å
SCOPe Domain Sequences for d1e4eb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e4eb1 c.30.1.2 (B:2-131) D-alanine:D-lactate ligase VanA, N-domain {Enterococcus faecium [TaxId: 1352]} nrikvailfggcseehdvsvksaieiaaninkekyeplyigitksgvwkmcekpcaewen encysavlspdkkmhgllvkknheyeinhvdvafsalhgksgedgsiqglfelsgipfvg cdiqssaicm
Timeline for d1e4eb1: