SCOPe 2.08: Domain d1e4eb1: 1e4e B:2-131

Lineage for d1e4eb1 (1e4e B:2-131)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (10 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.2: D-Alanine ligase N-terminal domain [52452] (2 proteins)

6. Protein D-alanine:D-lactate ligase VanA, N-domain [52455] (2 species)

7. Species Enterococcus faecium [TaxId:1352] [63983] (1 PDB entry)

8. Domain d1e4eb1: 1e4e B:2-131 [59223]
   Other proteins in same PDB: d1e4ea2, d1e4eb2
   complexed with adp, gol, mg, phy, so4

Details for d1e4eb1

PDB Entry: 1e4e, 2.5 Å

PDB Description: d-alanyl-d-lacate ligase

PDB Compounds: (B:) vancomycin/teicoplanin a-type resistance protein vana

SCOPe Domain Sequences for d1e4eb1:

Sequence; same for both SEQRES and ATOM records:

>d1e4eb1 c.30.1.2 (B:2-131) D-alanine:D-lactate ligase VanA, N-domain {Enterococcus faecium [TaxId: 1352]}
nrikvailfggcseehdvsvksaieiaaninkekyeplyigitksgvwkmcekpcaewen
encysavlspdkkmhgllvkknheyeinhvdvafsalhgksgedgsiqglfelsgipfvg
cdiqssaicm

Timeline for d1e4eb1:

• d1e4eb1 first appeared in SCOP 1.57
  
• d1e4eb1 appears in SCOPe 2.07