Lineage for d1dcqa1 (1dcq A:369-522)
- Root: SCOPe 2.04
Class d: Alpha and beta proteins (a+b) [53931] (380 folds) 
Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
multiple repeats of beta(2)-alpha(2) motifSuperfamily d.211.1: Ankyrin repeat [48403] (2 families) 
repeats organized in elongated structuresFamily d.211.1.1: Ankyrin repeat [48404] (18 proteins)
this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain
Protein Pyk2-associated protein beta [48423] (1 species) Species Mouse (Mus musculus) [TaxId:10090] [48424] (1 PDB entry) 
Domain d1dcqa1: 1dcq A:369-522 [19178]
Other proteins in same PDB: d1dcqa2
complexed with zn
Details for d1dcqa1
PDB Entry: 1dcq (more details), 2.1 Å
PDB Description: crystal structure of the arf-gap domain and ankyrin repeats of papbeta.
PDB Compounds: (A:) pyk2-associated protein betaSCOPe Domain Sequences for d1dcqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]}
adtaaklhslceavktrdifgllqayadgvdltekiplanghepdetalhlavrsvdrts
lhivdflvqnsgnldkqtgkgstalhyccltdnaeclklllrgkasieianesgetpldi
akrlkhehceelltqalsgrfnshvhveyewrll
SCOPe Domain Coordinates for d1dcqa1:
Click to download the PDB-style file with coordinates for d1dcqa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1dcqa1:
- d1dcqa1 first appeared (with stable ids) in SCOP 1.55
- d1dcqa1 appears in SCOPe 2.03
- d1dcqa1 appears in SCOPe 2.05
- d1dcqa1 appears in the current release, SCOPe 2.08
View in 3D
