Lineage for d1dcqa1 (1dcq A:369-522)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1445942Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
    multiple repeats of beta(2)-alpha(2) motif
  4. 1445943Superfamily d.211.1: Ankyrin repeat [48403] (2 families) (S)
    repeats organized in elongated structures
  5. 1445944Family d.211.1.1: Ankyrin repeat [48404] (18 proteins)
    this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain
  6. 1446019Protein Pyk2-associated protein beta [48423] (1 species)
  7. 1446020Species Mouse (Mus musculus) [TaxId:10090] [48424] (1 PDB entry)
  8. 1446021Domain d1dcqa1: 1dcq A:369-522 [19178]
    Other proteins in same PDB: d1dcqa2
    complexed with zn

Details for d1dcqa1

PDB Entry: 1dcq (more details), 2.1 Å

PDB Description: crystal structure of the arf-gap domain and ankyrin repeats of papbeta.
PDB Compounds: (A:) pyk2-associated protein beta

SCOPe Domain Sequences for d1dcqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]}
adtaaklhslceavktrdifgllqayadgvdltekiplanghepdetalhlavrsvdrts
lhivdflvqnsgnldkqtgkgstalhyccltdnaeclklllrgkasieianesgetpldi
akrlkhehceelltqalsgrfnshvhveyewrll

SCOPe Domain Coordinates for d1dcqa1:

Click to download the PDB-style file with coordinates for d1dcqa1.
(The format of our PDB-style files is described here.)

Timeline for d1dcqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dcqa2