Lineage for d1dcqa1 (1dcq A:369-522)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.118: alpha-alpha superhelix [48370] (11 superfamilies) 
Superfamily a.118.2: Ankyrin repeat [48403] (1 family) 
Family a.118.2.1: Ankyrin repeat [48404] (9 proteins) 
Protein Pyk2-associated protein beta [48423] (1 species) Species Mouse (Mus musculus) [TaxId:10090] [48424] (1 PDB entry) 
Domain d1dcqa1: 1dcq A:369-522 [19178]
Other proteins in same PDB: d1dcqa2
Details for d1dcqa1
PDB Entry: 1dcq (more details), 2.1 Å
PDB Description: crystal structure of the arf-gap domain and ankyrin repeats of papbeta.
SCOP Domain Sequences for d1dcqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dcqa1 a.118.2.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus)}
adtaaklhslceavktrdifgllqayadgvdltekiplanghepdetalhlavrsvdrts
lhivdflvqnsgnldkqtgkgstalhyccltdnaeclklllrgkasieianesgetpldi
akrlkhehceelltqalsgrfnshvhveyewrll
SCOP Domain Coordinates for d1dcqa1:
Click to download the PDB-style file with coordinates for d1dcqa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1dcqa1:
- d1dcqa1 appears in SCOP 1.57
- d1dcqa1 appears in the current release, SCOPe 2.08
View in 3D
