Lineage for d1dcqa2 (1dcq A:247-368)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1707036Fold g.45: ArfGap/RecO-like zinc finger [57862] (1 superfamily)
    zinc-bound alpha+beta motif
  4. 1707037Superfamily g.45.1: ArfGap/RecO-like zinc finger [57863] (3 families) (S)
  5. 1707038Family g.45.1.1: Pyk2-associated protein beta ARF-GAP domain [57864] (1 protein)
    automatically mapped to Pfam PF01412
  6. 1707039Protein Pyk2-associated protein beta ARF-GAP domain [57865] (1 species)
    core is similar to that of the RING finger but lacks one zinc-binding site
  7. 1707040Species Mouse (Mus musculus) [TaxId:10090] [57866] (1 PDB entry)
  8. 1707041Domain d1dcqa2: 1dcq A:247-368 [45326]
    Other proteins in same PDB: d1dcqa1
    complexed with zn

Details for d1dcqa2

PDB Entry: 1dcq (more details), 2.1 Å

PDB Description: crystal structure of the arf-gap domain and ankyrin repeats of papbeta.
PDB Compounds: (A:) pyk2-associated protein beta

SCOPe Domain Sequences for d1dcqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dcqa2 g.45.1.1 (A:247-368) Pyk2-associated protein beta ARF-GAP domain {Mouse (Mus musculus) [TaxId: 10090]}
ltkeiisevqrmtgndvccdcgapdptwlstnlgiltciecsgihrelgvhysrmqsltl
dvlgtselllaknignagfneimecclpsedpvkpnpgsdmiarkdyitakymerryark
kh

SCOPe Domain Coordinates for d1dcqa2:

Click to download the PDB-style file with coordinates for d1dcqa2.
(The format of our PDB-style files is described here.)

Timeline for d1dcqa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dcqa1