Class g: Small proteins [56992] (90 folds) |
Fold g.45: ArfGap/RecO-like zinc finger [57862] (1 superfamily) zinc-bound alpha+beta motif |
Superfamily g.45.1: ArfGap/RecO-like zinc finger [57863] (3 families) |
Family g.45.1.1: Pyk2-associated protein beta ARF-GAP domain [57864] (1 protein) automatically mapped to Pfam PF01412 |
Protein Pyk2-associated protein beta ARF-GAP domain [57865] (1 species) core is similar to that of the RING finger but lacks one zinc-binding site |
Species Mouse (Mus musculus) [TaxId:10090] [57866] (1 PDB entry) |
Domain d1dcqa2: 1dcq A:247-368 [45326] Other proteins in same PDB: d1dcqa1 complexed with zn |
PDB Entry: 1dcq (more details), 2.1 Å
SCOPe Domain Sequences for d1dcqa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dcqa2 g.45.1.1 (A:247-368) Pyk2-associated protein beta ARF-GAP domain {Mouse (Mus musculus) [TaxId: 10090]} ltkeiisevqrmtgndvccdcgapdptwlstnlgiltciecsgihrelgvhysrmqsltl dvlgtselllaknignagfneimecclpsedpvkpnpgsdmiarkdyitakymerryark kh
Timeline for d1dcqa2: