Lineage for d1be3j_ (1be3 J:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026015Superfamily f.23.14: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81514] (1 family) (S)
    automatically mapped to Pfam PF05365
  5. 3026016Family f.23.14.1: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81513] (2 proteins)
  6. 3026017Protein Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81512] (3 species)
    interacts with cytochrome c1 and ISP
  7. 3026028Species Cow (Bos taurus) [TaxId:9913] [81509] (20 PDB entries)
    Uniprot P00130
  8. 3026049Domain d1be3j_: 1be3 J: [43671]
    Other proteins in same PDB: d1be3a1, d1be3a2, d1be3b1, d1be3b2, d1be3c2, d1be3c3, d1be3d2, d1be3d3, d1be3e1, d1be3e2, d1be3f_, d1be3g_, d1be3h_, d1be3i_, d1be3k_
    complexed with fes, hec, hem

Details for d1be3j_

PDB Entry: 1be3 (more details), 3 Å

PDB Description: cytochrome bc1 complex from bovine
PDB Compounds: (J:) cytochrome bc1 complex

SCOPe Domain Sequences for d1be3j_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1be3j_ f.23.14.1 (J:) Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]}
vaptltarlysllfrrtstfaltivvgalfferafdqgadaiyehinegklwkhikhkye
nk

SCOPe Domain Coordinates for d1be3j_:

Click to download the PDB-style file with coordinates for d1be3j_.
(The format of our PDB-style files is described here.)

Timeline for d1be3j_: