Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.11: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81496] (2 families) |
Family f.23.11.1: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81495] (1 protein) |
Protein Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81494] (4 species) |
Species Cow (Bos taurus) [TaxId:9913] [81491] (19 PDB entries) Uniprot P00125 |
Domain d1be3d3: 1be3 D:196-241 [43666] Other proteins in same PDB: d1be3a1, d1be3a2, d1be3b1, d1be3b2, d1be3c2, d1be3c3, d1be3d2, d1be3e1, d1be3e2, d1be3f_, d1be3g_, d1be3h_, d1be3i_, d1be3j_, d1be3k_ complexed with fes, hec, hem |
PDB Entry: 1be3 (more details), 3 Å
SCOPe Domain Sequences for d1be3d3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1be3d3 f.23.11.1 (D:196-241) Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor {Cow (Bos taurus) [TaxId: 9913]} pehdhrkrmglkmllmmglllplvyamkrhkwsvlksrklayrppk
Timeline for d1be3d3: