| Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
| Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies) core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices |
Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families) ![]() Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically |
| Family f.21.1.2: Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81642] (3 proteins) a part (domain) of a larger mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria |
| Protein Mitochondrial cytochrome b subunit, N-terminal domain [81641] (3 species) also includes extra transmembrane (linker) helix absent in plants and cyanobacteria subunits |
| Species Cow (Bos taurus) [TaxId:9913] [81638] (19 PDB entries) Uniprot P00157 |
| Domain d1be3c3: 1be3 C:1-260 [75806] Other proteins in same PDB: d1be3a1, d1be3a2, d1be3b1, d1be3b2, d1be3c2, d1be3d2, d1be3d3, d1be3e1, d1be3e2, d1be3f_, d1be3g_, d1be3h_, d1be3i_, d1be3j_, d1be3k_ complexed with fes, hec, hem |
PDB Entry: 1be3 (more details), 3 Å
SCOPe Domain Sequences for d1be3c3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1be3c3 f.21.1.2 (C:1-260) Mitochondrial cytochrome b subunit, N-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
mtnirkshplmkivnnafidlpapsnisswwnfgsllgiclilqiltglflamhytsdtt
tafssvthicrdvnygwiirymhangasmfficlymhvgrglyygsytfletwnigvill
ltvmatafmgyvlpwgqmsfwgatvitnllsaipyigtnlvewiwggfsvdkatltrffa
fhfilpfiimaiamvhllflhetgsnnptgissdvdkipfhpyytikdilgalllilalm
llvlfapdllgdpdnytpan
Timeline for d1be3c3: