Lineage for d1b3qa3 (1b3q A:355-539)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2973214Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2973215Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2973838Family d.122.1.3: Histidine kinase [55884] (8 proteins)
  6. 2973851Protein Histidine kinase CheA [55887] (2 species)
  7. 2973852Species Thermotoga maritima [TaxId:2336] [55888] (8 PDB entries)
  8. 2973863Domain d1b3qa3: 1b3q A:355-539 [41112]
    Other proteins in same PDB: d1b3qa1, d1b3qa2, d1b3qb1, d1b3qb2
    complexed with hg

Details for d1b3qa3

PDB Entry: 1b3q (more details), 2.6 Å

PDB Description: crystal structure of chea-289, a signal transducing histidine kinase
PDB Compounds: (A:) protein (chemotaxis protein chea)

SCOPe Domain Sequences for d1b3qa3:

Sequence, based on SEQRES records: (download)

>d1b3qa3 d.122.1.3 (A:355-539) Histidine kinase CheA {Thermotoga maritima [TaxId: 2336]}
mvpisfvfnrfprmvrdlakkmnkevnfimrgedteldrtfveeigepllhllrnaidhg
iepkeeriakgkppigtlilsarhegnnvvieveddgrgidkekiirkaiekglideska
atlsdqeilnflfvpgfstkekvsevsgrgvgmdvvknvveslngsmgiesekdkgtkvt
irlpl

Sequence, based on observed residues (ATOM records): (download)

>d1b3qa3 d.122.1.3 (A:355-539) Histidine kinase CheA {Thermotoga maritima [TaxId: 2336]}
mvpisfvfnrfprmvrdlakkmnkevnfimrgedteldrtfveeigepllhllrnaidhg
iepkeeriakgkppigtlilsarhegnnvvieveddgrgidkekiirkaiekglideska
atlsdqeilnflfvpgfsgvgmdvvknvveslngsmgiesekdkgtkvtirlpl

SCOPe Domain Coordinates for d1b3qa3:

Click to download the PDB-style file with coordinates for d1b3qa3.
(The format of our PDB-style files is described here.)

Timeline for d1b3qa3: