Lineage for d1adra_ (1adr A:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1087132Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 1087133Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 1087154Family a.35.1.2: Phage repressors [47419] (7 proteins)
    consists of different sequence families of HTH repressors of phage origins
  6. 1087216Protein P22 C2 repressor, DNA-binding domain [47426] (1 species)
  7. 1087217Species Salmonella bacteriophage P22 [TaxId:10754] [47427] (5 PDB entries)
    contains a short additional helix at C-terminus
  8. 1087226Domain d1adra_: 1adr A: [17042]

Details for d1adra_

PDB Entry: 1adr (more details)

PDB Description: determination of the nuclear magnetic resonance structure of the dna- binding domain of the p22 c2 repressor (1-76) in solution and comparison with the dna-binding domain of the 434 repressor
PDB Compounds: (A:) p22 c2 repressor

SCOPe Domain Sequences for d1adra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1adra_ a.35.1.2 (A:) P22 C2 repressor, DNA-binding domain {Salmonella bacteriophage P22 [TaxId: 10754]}
mntqlmgerirarrkklkirqaalgkmvgvsnvaisqwersetepngenllalskalqcs
pdyllkgdlsqtnvay

SCOPe Domain Coordinates for d1adra_:

Click to download the PDB-style file with coordinates for d1adra_.
(The format of our PDB-style files is described here.)

Timeline for d1adra_: