PDB entry 1adr

View 1adr on RCSB PDB site
Description: determination of the nuclear magnetic resonance structure of the DNA-binding domain of the p22 c2 repressor (1-76) in solution and comparison with the DNA-binding domain of the 434 repressor
Class: transcription regulation
Keywords: transcription regulation
Deposited on 1993-07-19, released 1994-01-31
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: p22 c2 repressor
    Species: Enterobacteria phage P22 [TaxId:10754]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1adra_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1adrA (A:)
mntqlmgerirarrkklkirqaalgkmvgvsnvaisqwersetepngenllalskalqcs
pdyllkgdlsqtnvay